PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG000451t1
Common NameTCM_000451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family BES1
Protein Properties Length: 321aa    MW: 34367.5 Da    PI: 8.9305
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG000451t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822221.61.7e-6831471149
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 
                       g++gr ptwkErEnnkrRERrRRaiaakiy+GLRaqGnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp+  +e ag+s+++s +ss
  Thecc1EG000451t1   3 GAAGRLPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGCKPP-LSELAGASTNISACSS 94 
                       689*************************************************************************.9*************** PP

            DUF822  94 lqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsss 149
                       +q s++ss+++spv+sy+asp+ss  psp+++d +++   + llp+l++ ++++++
  Thecc1EG000451t1  95 IQPSPQSSSFPSPVPSYHASPSSSLCPSPTRFDANPS---TYLLPFLRNIAAIPNN 147
                       ***********************************88...5999999999888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.2E-645128IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MTGAAGRLPT WKERENNKRR ERRRRAIAAK IYTGLRAQGN YKLPKHCDNN EVLKALCAEA  60
GWIVEEDGTT YRKGCKPPLS ELAGASTNIS ACSSIQPSPQ SSSFPSPVPS YHASPSSSLC  120
PSPTRFDANP STYLLPFLRN IAAIPNNLPP LRISNSAPVT PPLSSPTSRG SKPKADWESL  180
SNGSLNSCRH PLFATSAPSS PTRRHHKTPA TIPECDESDA STVDSGRWVS FQTVASTAAA  240
AVAAPPSPTF NLVKRVVQQN PLQDGVTGHG GVTWGTVTEI GRGSEFEFEN GRVKPWEGER  300
IHEIGVDDLE LTLGTSKTCA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF3134710.0KF313471.1 Firmiana danxiaensis microsatellite a4587_SSR8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047017.10.0Brassinosteroid signaling positive regulator family protein isoform 1
SwissprotQ94A431e-119BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLA0A061DFW60.0A0A061DFW6_THECC; Brassinosteroid signaling positive regulator family protein isoform 1
STRINGPOPTR_0007s12370.11e-157(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115122333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.25e-91BES1 family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]